SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010049 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010049
Domain Number 1 Region: 596-882
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-82
Family Protein kinases, catalytic subunit 0.00000000366
Further Details:      
 
Domain Number 2 Region: 2-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-69
Family Ephrin receptor ligand binding domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 296-503
Classification Level Classification E-value
Superfamily Fibronectin type III 1.47e-40
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 902-969
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.26e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010049
Domain Number - Region: 221-293,328-353
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000123
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010049   Gene: ENSNLEG00000008246   Transcript: ENSNLET00000010544
Sequence length 973
Comment pep:novel supercontig:Nleu1.0:GL397339.1:3526610:3681593:1 gene:ENSNLEG00000008246 transcript:ENSNLET00000010544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRTSWIPRD
GARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKIDTIAADE
SFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRNLA
AFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDA
CVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAP
VNLISSVNGTSVTLEWAPPLDPGGRSDVTYNAVCRRCPWALSRCEACGSGTRFVPQQTSL
VQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVIRQERAG
QTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQV
RARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLVVLLLLLICKKRHCGYSK
AFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAEPHTYEEPGRAGRSFTREIEA
SRIHIEKIIGSGESGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFD
HPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQFTIMQLLGMLRGVGAGMRYLS
HLGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAF
RTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPRALHQLML
DCWHKDRAQRPRFSQIVSVLDALIRSPESLRATATVSRCPPPAFARSCFDLRGGSGGGGG
LTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMR
AQLTSTQGPRRHL
Download sequence
Identical sequences ENSNLEP00000010049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]