SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010352 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010352
Domain Number 1 Region: 378-495
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 158-266
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-26
Family Cadherin 0.00022
Further Details:      
 
Domain Number 3 Region: 267-383
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 488-595
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 79-165
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000771
Family Cadherin 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010352
Domain Number - Region: 584-648
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00861
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010352   Gene: ENSNLEG00000008475   Transcript: ENSNLET00000010859
Sequence length 801
Comment pep:novel supercontig:Nleu1.0:GL397295.1:7060640:7121392:1 gene:ENSNLEG00000008475 transcript:ENSNLET00000010859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTSGRMSNAKNWLGLGMSLYFWGLMDLTTTVLSDTPTPQGELEALLSDKPQSHQRTKRS
WVWNQFFVLEEYTGTDPLYVGKLHSDMDRGDGSIKYILSGEGAGIVFTIDDTTGDIHAIQ
RLDREERAQYTLRAQALDRRTGRPMEPESEFIIKIQDINDNEPKFLDGPYVATVPEMSPV
GTSVIQVTATDADDPTYGNSARVVYSILQGQPYFSVDSKTGVIRTALMNMDREAKEYYEV
IIQAKDMGGQLGGLAGTTTVNITLSDVNDNPPRFPQKHYQMSVLESAPISSTVGRVFAKD
LDEGINAEMKYTIVDGDGADAFDISTDPNFQVGIITVKKPLSFESKKSYTLKVEGANPHL
EMRFLNLGPFQDTTTVHISVEDVDEPPVFEPGFYSVEVPEDVAIGTTIQIISAKDPDVTN
NSIRYSIDRSSDPGRFFYVDITTGALMTARPLDREEFSWHNITVLAMEMNNPSQVGSVPV
TIKVLDVNDNAPEFPRFYEAFVCENAKAGQLIQTVSAVDQDDPRNGQHFYYSLAPEAANN
PNFTIRDNQDNTARILTRRSGFRQQEQSVFHLPILIADSGQPVLSSTGTLTIQVCSCDDD
GHVMSCSPEAYMLPVSLSRGALIAILACIFVLLVLVLLILSMRRHRKQPYIIDDEENIHE
NIVRYDDEGGGEEDTEAFDIAAMWNPREAQAGAAPKTRQDMLPEIESLSRYVPQTCAVNS
TVHSYVLAKLYEADMDLWAPPFDSLQTYMFEGDGSVAGSLSSLQSATSDSEQNFDFLTDW
GPRFRKLAELYGASEGPAPLW
Download sequence
Identical sequences G1RAV5
ENSNLEP00000010352 ENSNLEP00000010352 XP_003264336.1.23891 XP_003264337.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]