SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010609 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010609
Domain Number 1 Region: 103-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000342
Family EGF-type module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010609   Gene: ENSNLEG00000008696   Transcript: ENSNLET00000011125
Sequence length 337
Comment pep:novel supercontig:Nleu1.0:GL398614.1:3797:15674:1 gene:ENSNLEG00000008696 transcript:ENSNLET00000011125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFCIWLTLLGAETQDSRGCAPWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDGIAQ
CQWGTEVVVRGHSLTFQTTAPHGGSCLPGYELASGAKTFKNDSENTCQDVDECQQNPRLC
KSYGTCVNTLGSYACQCLPGFKIKPEDPKLCTGRSRHTAGRRQGLRGLECPYLTPSSSVR
CEWKKVRGTSTMTREGADEKMTFPIWTPPPGVHSQSLSRFFDKQDLRRDYEPGLVKSSIQ
SILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSEGLLNFSYPAGTE
LSLEVQEQVDRNVTLRQNQQDAADWNLAQKSGDPGNG
Download sequence
Identical sequences ENSNLEP00000010609 ENSNLEP00000010609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]