SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011124 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011124
Domain Number 1 Region: 714-971
Classification Level Classification E-value
Superfamily RNI-like 1.28e-48
Family 28-residue LRR 0.0000648
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-21
Family Pyrin domain, PYD 0.00000374
Further Details:      
 
Domain Number 3 Region: 1376-1462
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-16
Family Caspase recruitment domain, CARD 0.02
Further Details:      
 
Domain Number 4 Region: 322-498
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000077
Family Nucleotide and nucleoside kinases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011124   Gene: ENSNLEG00000009130   Transcript: ENSNLET00000011675
Sequence length 1473
Comment pep:novel supercontig:Nleu1.0:GL397365.1:485247:544852:-1 gene:ENSNLEG00000009130 transcript:ENSNLET00000011675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPTQPEKTSGMEVASYLVAQ
YGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPW
ICELPAGCTQGSERRVLRQLPDTSGRRWREISSSLLYQALPSSPDHESPSQESPSAPTST
AVLGSWGSPPQPSPAPREQEAPGTQWPLDETSGNYYTEIREREIEKSEKGRPPWAAAVGT
PPEVHASLQPHRHPWEPSGRESLCSTWPWKNEDLNQKFTQLLLLQRPHPRSQEPLVKESW
PPDVEEDRGHLIEIGDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVREAWGRGQLYGDR
FQHVFYFSCRELAQSKVVSLAELIAKDCTAAQAPIRQILSRPERLLFILDGVDEPGWVLQ
EPSSELCLHWSQPRPVDALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLG
FSESSRKEYFYKYFTGERQAITAFRLVKSNKELWALCLVPWVSWLACTCLMQQIKRKEKL
TLTSKTTTTLCLRYLSQALQAQPLGPQLRDLCSLAAEGVWQKKTLFSPDDLRKHGLDGAI
ISTLLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYALEDKKGRGKHSNCIIHLEKLLEAY
GTHGLFGAPTTRFLLGLLSDEGEREMKNIFHCRLSQGRKLMRWVPSLQPLLQPHSLEFLH
CLYETQNKTFLTQVMAHFQELGMCVETDMELLVCTFCIKFSPHVKKLQLIEGRQHRPAWS
PTRVVLFRWAPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRCPRCLLE
TLRLAGCGLTAQDCKDIASGLRANQTLTELDLSFNVLRDAGAKRLCQTLRWPSCKLQRLQ
LVSCGLTSGCCQDLASMLSTSSSLMGLDLQQNNLGDAGVRLLREGLRHPACQLTSLGLDQ
MTLSDEMRQQLRALEQEKPQLLIFSRRKPSVMIPNEGMDTRETSNSTSSLTQQRLGSGRP
ALGRAPYSQAGESGADRCLAVSEGSSPKVVLVEPLRTPSPASQGDLLTKALGTDDDFWGP
TGPVATEIVDKERSLYRVHFPVAGSYRWPNTGLCFVVREAVTIEIEFCVWDQFLGEINPQ
QSWMVAGPLLDIKAEPGAVEAVHLPHFVVLQGGRVDTSLFQVAHFKEEGMLLEKPARVEL
HHIVLENPSFSPLGVLLKMIHNALHFLPVTSMVLLYHRLHPEEITFHLYLIPSDCSIRKA
IDDEEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGSGMLEILPKELELCYRSPGEDQLF
SEFYVGHLGSGIRLQLKDKKDETLVWEALVKPGDLMPATTVVPPACIGLPSPLDAPRLLH
FVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAEDTRPSQMRKLFSLSQSWDRRC
KDGLYQALKETHPYLIMELWEKGSKKGLLPLSS
Download sequence
Identical sequences ENSNLEP00000011124 ENSNLEP00000011124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]