SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011250 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011250
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.83e-29
Family Txnl5-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011250   Gene: ENSNLEG00000009230   Transcript: ENSNLET00000011804
Sequence length 123
Comment pep:novel supercontig:Nleu1.0:GL397365.1:1630915:1634550:1 gene:ENSNLEG00000009230 transcript:ENSNLET00000011804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI
SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF
SED
Download sequence
Identical sequences A0A140VJY7 A0A2I3H5Q4 G3QKM5 H2QC11 Q9BRA2
ENSPTRP00000014752 1wouA ENSP00000250101 ENSGGOP00000003003 NP_116120.1.87134 NP_116120.1.92137 XP_003274631.1.23891 XP_003810187.1.60992 XP_004058471.1.27298 XP_511988.2.37143 9598.ENSPTRP00000014752 9606.ENSP00000250101 ENSPTRP00000014752 ENSP00000250101 ENSP00000250101 cath|current|1wouA00/4-122 gi|14249348|ref|NP_116120.1| 1wou_A ENSNLEP00000011250 ENSGGOP00000003003 ENSNLEP00000011250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]