SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011334 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011334
Domain Number 1 Region: 89-398
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000181
Family 28-residue LRR 0.046
Further Details:      
 
Domain Number 2 Region: 8-68
Classification Level Classification E-value
Superfamily F-box domain 0.000000000445
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011334   Gene: ENSNLEG00000009306   Transcript: ENSNLET00000011893
Sequence length 442
Comment pep:novel supercontig:Nleu1.0:GL397365.1:1812693:1821149:1 gene:ENSNLEG00000009306 transcript:ENSNLET00000011893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEESELIQPQDQSCWATLPDVCLCRVFWWLGDRDRSRAALVCRKWNQMMYSADLWRYRT
ITFSGRPSRVHASEVESALWYVKKFGRYLERLEVKFLNPYNAVLTRKFQVTMRGLLSRLS
KSNNRLKSLSIQYLELDRLVWRNSIRSSFIKSLSFFLKKMGKHLEYLNLKGARLTVEQGC
QILDSLSYMRNENMISELNIEDYFSHHLAVYSSPQFKKTMSTFHRLVSLNLNYNCISDEL
LENLCENASTLRTINIKCHIHDPHGQVIWGMSWAKLARQATNLKVNFFFERIMKYERLAR
ILLQEIPIRSISLRSCYFSDPDWSMRPTLIDLLPTFRHTLQKLTCEFNNNHESLDEELHL
LIISCRKLFYFKIWAFLDVTFVERILKSQKERQCALRIFKVRIYTNRNDTNEEDKTLREI
YRKYRKLIESELSYLVIAYSIM
Download sequence
Identical sequences G1RDN5
ENSNLEP00000011334 ENSNLEP00000011334 XP_003274642.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]