SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011364 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011364
Domain Number 1 Region: 85-250
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-39
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 318-457
Classification Level Classification E-value
Superfamily PapD-like 1.39e-37
Family MSP-like 0.000000203
Further Details:      
 
Domain Number 3 Region: 35-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000288
Family CRAL/TRIO N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011364   Gene: ENSNLEG00000009316   Transcript: ENSNLET00000011923
Sequence length 518
Comment pep:novel supercontig:Nleu1.0:GL397281.1:12209925:12258746:1 gene:ENSNLEG00000009316 transcript:ENSNLET00000011923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDE
TLKMLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQK
TILDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS
KIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST
SKAEENEKVDSKMKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV
AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLES
NRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS
Download sequence
Identical sequences G1RDR5
ENSNLEP00000011364 ENSNLEP00000011364 XP_003261115.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]