SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011617 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011617
Domain Number 1 Region: 1025-1117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 1485-1568
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 1296-1376
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-17
Family I set domains 0.065
Further Details:      
 
Domain Number 4 Region: 484-577
Classification Level Classification E-value
Superfamily Immunoglobulin 3.92e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 665-760
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000665
Family I set domains 0.03
Further Details:      
 
Domain Number 6 Region: 756-841
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000168
Family I set domains 0.04
Further Details:      
 
Domain Number 7 Region: 575-670
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000183
Family I set domains 0.037
Further Details:      
 
Domain Number 8 Region: 405-496
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000705
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 18-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000783
Family I set domains 0.019
Further Details:      
 
Domain Number 10 Region: 1122-1207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000995
Family I set domains 0.015
Further Details:      
 
Domain Number 11 Region: 1394-1480
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000147
Family I set domains 0.0036
Further Details:      
 
Domain Number 12 Region: 937-1026
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000424
Family I set domains 0.015
Further Details:      
 
Domain Number 13 Region: 1214-1302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000186
Family I set domains 0.004
Further Details:      
 
Domain Number 14 Region: 200-289
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000408
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 15 Region: 118-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000338
Family I set domains 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011617
Domain Number - Region: 304-401
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000154
Family I set domains 0.021
Further Details:      
 
Domain Number - Region: 863-898
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000483
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011617   Gene: ENSNLEG00000009540   Transcript: ENSNLET00000012191
Sequence length 1580
Comment pep:novel supercontig:Nleu1.0:GL397345.1:1437306:1456828:-1 gene:ENSNLEG00000009540 transcript:ENSNLET00000012191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYVCSARNSASQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFR
EDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILKRLP
RKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVTREDAGEV
TFSLGNSRTTTLLRVKCVKHSPPGPPISAEMFKGHKNTVLLTWKPPEPAPETPFIYRLER
QEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRVCTVSGHGRSPHVVFHGSAHLVPT
ARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRMEHK
GLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDKMSLTFTTSERVV
LTCELSRVDFPATWYKDGQKVEESELLVMKMDGRKHRLILPEAKVQDSGEFECRTEGVSA
FFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVHWYKDGQEVEESDFVVL
ENEGPHRRLVLPATQPSDGGEFQCVAGDERAYFTVTITDVSSWIVYPSGKVYVAAVRLER
VVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDE
SASFTVTVTEPPVRIIYPHDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEAL
VLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGA
PGRVELRCEVAPAGSQVRWYKDGLEVEASDTLQLGAEGPTRTLTLPHAQPEDAGEYVCET
RDEAITFNVILAEPPVQFLAPETTPSPLCVAPGEPVMLSCELSRAGAPVVWSHNRPHALP
IPGPTSLSTRPLMPPPALLKALSLSLPVTSSSDSTEPPVRVVAPEAAQTRVRSTPGGDLE
LVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQRAQSRDAGEYLCDAPQDSR
IFLVSVEEPLPVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLHNGAVITPGPQVEMA
QNGSSHILTLRGCQLEDAGTVTVRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCL
EVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDR
TLARLSVRPRQLRVLRPLEDVTVSEGGSATFQLELSQEGVTGEWARGGVRLYPGPKCHIH
SEGHCHRLVLNGLGLADSGCVSFTADSLRCAARLVVREVPVTIVRGPQDLEVTEGDTATF
ECELSQALADVTWEKDGSALTSSPRLRLQALGTRRLLQLRRCGLSDAGTYSCAVGTARAG
PVRLTVRERTVAVLSELRSVSAREGDCATFECTVSEVETTGRWELGGRPLRPGAHVRIRQ
EGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVL
EVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSAH
TRLLVEAPCGVIPLQVTRRT
Download sequence
Identical sequences ENSNLEP00000011617 ENSNLEP00000011617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]