SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011691 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011691
Domain Number 1 Region: 612-906
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.66e-75
Family Ephrin receptor ligand binding domain 0.000000746
Further Details:      
 
Domain Number 3 Region: 328-531
Classification Level Classification E-value
Superfamily Fibronectin type III 9.69e-29
Family Fibronectin type III 0.00025
Further Details:      
 
Domain Number 4 Region: 909-981
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.99e-20
Family SAM (sterile alpha motif) domain 0.0000452
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011691
Domain Number - Region: 259-330,366-390
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000259
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011691   Gene: ENSNLEG00000009595   Transcript: ENSNLET00000012266
Sequence length 985
Comment pep:novel supercontig:Nleu1.0:GL397345.1:3356166:3501941:-1 gene:ENSNLEG00000009595 transcript:ENSNLET00000012266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPNPDQSVSVTVTTNQAGRNIYFIVCKEVSRYRCGTAGLEPDRPNGVILELEVKYYEK
DQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIG
DGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFT
YEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTD
KQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVI
QLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTT
RGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGY
RLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNTA
LLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITH
QNKILSSVQAMRTQMQQMHGRMVPV
Download sequence
Identical sequences ENSNLEP00000011691 ENSNLEP00000011691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]