SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011730 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011730
Domain Number 1 Region: 594-775
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-64
Family SPRY domain 0.00000277
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-24
Family Pyrin domain, PYD 0.0035
Further Details:      
 
Domain Number 3 Region: 366-431
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000305
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011730   Gene: ENSNLEG00000009630   Transcript: ENSNLET00000012307
Sequence length 781
Comment pep:novel supercontig:Nleu1.0:GL397322.1:3163834:3177612:-1 gene:ENSNLEG00000009630 transcript:ENSNLET00000012307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVEKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASNSLGENKPRILKT
PDHPEGKEGNGPRPYGDGAASLRCSQPEAGRGLSRKPLGKQREKAAEGLDAQGKPRTRSP
ALPSGRSPGPCRAPEGHQAEVQLRRNASSAGRLQGLAGGAPGRKECRPFEVYLPSGKRRP
RSLEFTISAGEKAPANPEILLTLEETTAANLDSATEPRARPTPDGGASADLEEGPGNPEH
SVTGRPPDKAASPRCHAQEGDPVGSTCVHDSCSCPEAVSGHPQASGSRSPGCPRCQASHE
RKSTGSLSPQPLPQCKRHMKQVQLLFCDDHSEPICLICSLSQEHQGHRVRPIEEAALEHK
KQIRKQLEHLKKLRKSGEEQRSYGEEKAVSFLKQTEVLKQRVQRKLEQVYHFLEQQEHFF
VASLEDVGQMVGQIRKAYDTRVSKDIALLDALIGELEAKQCQSEWELLQDIGDILHRAKT
VPVPEQWTTPQEMQQKIQFLHRKSEFVEKSAKYFSETLRSEMEMLNVPELIGAQAHAVNV
ILDAETAYPNLIFSDDLKSVRLGNKRGRLPDGPQRFDSCIVVLGSPSFLSGRHYWEVEVG
DKTAWILGACKASIIRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGI
FVDYRVGSISFYNVTARSHMYTFTSCSFSEPLQPIFGPGTHDGGKNTAPLTICPVGGQGP
D
Download sequence
Identical sequences G1RET0
XP_012352830.1.23891 ENSNLEP00000011730 ENSNLEP00000011730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]