SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011780 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011780
Domain Number 1 Region: 813-1102
Classification Level Classification E-value
Superfamily RNI-like 1.46e-53
Family 28-residue LRR 0.024
Further Details:      
 
Domain Number 2 Region: 674-885
Classification Level Classification E-value
Superfamily RNI-like 3.24e-49
Family 28-residue LRR 0.02
Further Details:      
 
Domain Number 3 Region: 190-270,305-348
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000741
Family Nitrogenase iron protein-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011780   Gene: ENSNLEG00000009681   Transcript: ENSNLET00000012360
Sequence length 1111
Comment pep:novel supercontig:Nleu1.0:GL397322.1:3456440:3491865:-1 gene:ENSNLEG00000009681 transcript:ENSNLET00000012360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMDAPRPPSLGVPGAASRPERLLDGGHGRQQVQALSSQLLDVIPDSMRKQEVRTGREAGQ
GHGTGSPAEQVKALMDLLAGKGSQGSPAPQAPERTPDAPLGPCSNDSRIQRHRKALLSKV
GGGPELGRPWHRLASLLLVEGLTDLQLREHDFTQVEPTRGGGRPARTVALDRLFLPLSRV
SVPPRVSITVGVAGMGKTTLVRHFVRLWAHGQVGKDFSLVLPLTFRDLNTHEKLCADRLI
CSVFPHVREPSLAVAVPARALLILDGLDECRTPLDFSNTVACTDPKKEIPVDHLITNIIR
GNLFPEVSIWITSRPSASGQIPGGLVDRMTEIRGFNEEEIKVCLEQMFPEDQALLDWMLS
QVQADRALYLMCTVPAFCRLTGAALGHLWRSRTGPQNAELWPPRTLCELYSWYFRMALSG
EGQEKGKASPRIEQVAHGGRKMVGTLGRLAFHGLLKKKYVFYEQDMKAFGVDLALLQGAP
CSCFLQREETLASSVAYCFTHLSLQEFVAAAYYYGASRRSIFDLFTESSVSWPRLGFLTH
FRSAAQRAMQAEDGRLDVFLRFLSGLLSPRVNALLAGSLLAQGEHQAYRTQVAELLQGCL
RPDAAVCAQAINILHCLHELQHTELARGVEEAMESGALARLTGPAHRAALAYLLQVSDTC
AQEANLSLSLSQGVLQSLLPQLLYCRKLMLDTNQFQDPVMELLGSVLSGKDCRIQKISLA
ENQISNKGAKALARSLLVNRSLTSLDLRSNSIGPQGAKALADALKINRTLTSLSLQGNTV
RDDGARSVAEALASTRTLSMLHLQKNSIGPMGAQQMADALKQNRSLKELMLSSNSIGDGG
AKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLXXXXXXXXXXGAQAI
AHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQAL
QLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGAPGAQVLGEALAVNR
TLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQH
INLQGNHVGDSGARMISEAIKTNAPTCTVEM
Download sequence
Identical sequences ENSNLEP00000011780 ENSNLEP00000011780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]