SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012252 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012252
Domain Number 1 Region: 466-529
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000318
Family Netrin-like domain (NTR/C345C module) 0.024
Further Details:      
 
Domain Number 2 Region: 285-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 3 Region: 402-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 95-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000103
Family Galactose-binding domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012252   Gene: ENSNLEG00000010054   Transcript: ENSNLET00000012850
Sequence length 530
Comment pep:novel supercontig:Nleu1.0:GL397365.1:4058282:4282914:1 gene:ENSNLEG00000010054 transcript:ENSNLET00000012850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRXXXXXXXXXXXXXXXLHTDMRPLSGGVIAFSTLDGRPSAHDFDNSPVLQE
CVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVGEWGAAAEPAAENISFKPSGR
KAGLLPHREAGPMXXXXXXXCKKGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTTGQ
CPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGK
LKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGD
Download sequence
Identical sequences ENSNLEP00000012252 ENSNLEP00000012252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]