SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012322 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012322
Domain Number 1 Region: 27-103
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000549
Family F-box domain 0.0095
Further Details:      
 
Domain Number 2 Region: 204-305,386-461
Classification Level Classification E-value
Superfamily RNI-like 0.000000000196
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012322   Gene: ENSNLEG00000010079   Transcript: ENSNLET00000012921
Sequence length 1188
Comment pep:novel supercontig:Nleu1.0:GL397305.1:16046616:16105449:1 gene:ENSNLEG00000010079 transcript:ENSNLET00000012921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRKKSVKTCIMNNEIPEEMTADETKDYMNQLSHEVLCHIFRYLPLQDIMCMECLSRKL
KEAVTLYLRVVRVVDLCAGRWWEYMPSGFTDSSFLTLLKKMPDVEQLYGLHPRYLERRRV
RGHEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVHILGKFRNRNGAFPIPPE
NKLKIPIGAKIQTLHLVGVNVPEIPCIPMLRHLYMKWVRLTKPQPFKDFLCISLRTFVMR
NCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQHVVEDSWRSGGFRNLHTIVL
GACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQFETLHLGYVDE
FLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVFSCIKYLAIYNCPHLHNPYNWI
SDHSRWTRLVDINLVRCHALKLDSFGQFIELLPSLEFISLDQMFREPPKGCARVGLSAGT
GIGVSSALVSNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADA
LNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTPITVHDSES
DDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQS
KQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDVYPSCSSTTASTVGNSSSHST
ASQSPDFVRTVNSGGSSEPSPTEVDVSRQCTCSPGGSEDSEAMEEGDAESSVCPRCCCHR
PQESQRRTSRCSDEERPSTSRACVVNGPDGTRSAFSFRTLPQGGSSGPAHDERTNGSGSG
ATGEDRRGSSQPESCDVQSNEDYPRRPLTRARSRLSHVLLVSESEVAKTKPRHAMKRKRT
ADKSTSTSDPVIEDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLK
HLKVENAPIVNRFDYAQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFS
GPYPYHICIIHEFSNPPNVRNKVRIRSWMDTIANINQELIKYEFFPEATRNEEDLKKYPK
YPWGREIYTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQ
LSADICMETIGEEISEMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYI
Download sequence
Identical sequences ENSNLEP00000012322 ENSNLEP00000024442 ENSNLEP00000012322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]