SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012367 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012367
Domain Number 1 Region: 831-878,979-1107
Classification Level Classification E-value
Superfamily RNI-like 6.91e-31
Family 28-residue LRR 0.046
Further Details:      
 
Domain Number 2 Region: 411-590
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000071
Family Nucleotide and nucleoside kinases 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012367   Gene: ENSNLEG00000010140   Transcript: ENSNLET00000012968
Sequence length 1129
Comment pep:novel supercontig:Nleu1.0:GL397322.1:10735861:10785447:1 gene:ENSNLEG00000010140 transcript:ENSNLET00000012968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLAPHPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEA
EIELYSEPDTDTINCDQFSRLLSDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFK
HIGPDEVIGESMEMPAEVGQKSQKRPFPEELPADLKHRKPAEPPTVVTGSFLMEPANDSS
TLPCLPLPALFNEEPASGQMCLEKTDQMPMPSSSSSLSCLNLPEGPIQFVSTISTLPQGL
WQISGAGTGVSSIFIYHGEVPQASQVPPPSGLTVHGLPTSPDRPGSTSPFAPSATDLPSM
PEPALTSRANMTEHKTSPTQSQAAGEVSNKLPKWPEPVEQFYRSLQDTYRAEPAGPDGIL
VEVDLVRARLERSSSKSLERELATPDWAERQLAQGGLAELLLAAKEHRRPRETRVIAVLG
KAGQGKSCWAGAVSRAWACGRLPQYDFVFSVPCHCLNRPGSAYRLQDLLFSLGPQPLVAA
DEVFSHILKRPDRVLLILDAFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKTLLRG
CTLLLTARPRGRLGQSLSKADTLFELSGFSTEQAQAYVMRYFESSGMTEHQDRALTLLQD
RPFLLSHSHSPTLCRAVCQLSEALLELGDDAKLPSTLTGLYVGLLGRAALNSPPGALAEL
AKLAWELGRRHQSTLQEDQFPSADVRNWAMAKGLVKHPPGAAESELAFPSFLLQCFLGAL
WLALNGDIKDKELPQYLALTPRKKRPYDNMVEGVPRFLAGLIFQPXXXXXGALVGPSATA
LATEAEGACEVLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPACLSFLGTRLT
PPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTGFRAALSDTVALWESLRQ
HGETKLLQAAEEKFTIEPFKVKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKLE
FALGPISGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLN
LSQNSITDLGAYKLAEALPSLAASLLRLSLYNNCICDVGAESLARVLPDMVSLRVMDVQY
NKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR
Download sequence
Identical sequences ENSNLEP00000012367 ENSNLEP00000012367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]