SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012902 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012902
Domain Number 1 Region: 19-117
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-21
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 1009-1149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000283
Family Nucleotide and nucleoside kinases 0.0027
Further Details:      
 
Domain Number 3 Region: 680-760
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000929
Family PDZ domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012902
Domain Number - Region: 178-440
Classification Level Classification E-value
Superfamily Tropomyosin 0.0242
Family Tropomyosin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012902   Gene: ENSNLEG00000010543   Transcript: ENSNLET00000013536
Sequence length 1154
Comment pep:novel supercontig:Nleu1.0:GL397370.1:87575:230281:1 gene:ENSNLEG00000010543 transcript:ENSNLET00000013536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEV
LNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVV
EEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTRVELLTFQERY
YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKME
EECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQELQSIIQAGKRSLPDSDKA
ILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELKCSTLGKDCEM
YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE
MVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDASPRTNGQEADDSSTS
EESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSPCG
SLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDVPHRSTVEEDNDSGGFDALD
LDDDSHERYSFGPSSVHSSSSSHQSEGLDAYDLEQVNLMFRKFSLERPFRPSVTSVGHVR
GPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHSVKPGSLAEKAGLREGHQLLLLEGCIR
GERQSVPLDTCTKEEAHWTIQRCSGPITLHYKVNHEGYRKLLKDMEDGLITSGDSFYIRL
NLNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQ
LLLVKLQRLMHRGSREEVDGAHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLL
QFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPDSELGKNLSL
IPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKT
ETIIYSREKNPNTFECITPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCE
KNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIG
DEQRKTIWVDEDQL
Download sequence
Identical sequences G1RI46
ENSNLEP00000012902 ENSNLEP00000023519 ENSNLEP00000012902 XP_003274997.1.23891 XP_012351716.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]