SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013011 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013011
Domain Number 1 Region: 549-980
Classification Level Classification E-value
Superfamily RNI-like 3.53e-78
Family 28-residue LRR 0.00000832
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-31
Family Pyrin domain, PYD 0.0034
Further Details:      
 
Domain Number 3 Region: 116-236,270-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000105
Family Nucleotide and nucleoside kinases 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013011   Gene: ENSNLEG00000010674   Transcript: ENSNLET00000013648
Sequence length 994
Comment pep:novel supercontig:Nleu1.0:GL397411.1:570771:615913:1 gene:ENSNLEG00000010674 transcript:ENSNLET00000013648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKLDRKDLCMKVMRERTGYTKAYQAHAKQKFSHLWSSKSVTEIH
LYFEEEVKQEECDHLDRLFAPKETGKQPRTVIIQGPQGIGKTTFLMKLMMAWSDNKIFRD
RFLYTFYFCCRELRELPAMSLADLISREWPDPAAPITEIVAQPERLLFIIDSFEELKGGL
NEPDSDLCGDLMEKQPVQVLLSSLLRKKMLPDASLLIAVKPVCPKELRDQVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LALTCQSTTSVYSSFVFNLFTPEGAEGPTPQSQRQLKALCSLAAEGMWTDAFEFREDDLR
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCVQEFCAALFYLLKGHFDHPHPAVRCV
QELLVANFKKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQFHQCLKSLGE
CGDPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNADLVVSAYCLKYCSSLR
KLCFSVQNVFETEDEHSSTSDYSLVCWHHICSVLTTSGHLRELQVEDSTLSESTFVTWCN
QLRHPSCRLQKLGINNVSFSGQSAQLFEVLFYQPDLKYLSLTLTKLSRDDVRSLCDALNY
PAGNVKELALVNCRLSPIDCEVLAGLLTNNKKLAYLNVSCNQLDAGLPLLCAALCSPDAV
LVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKRPDCCLDC
CLLVKCFITADGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHPDCRLEILGL
EECGLTSACCKDLASVLTSSKMLQQLNLTLNALDHTGVVVLCEALRHPACALQVLGLRKT
DFDEETQALLTAEEERNPDLTITDEFDTITRVEI
Download sequence
Identical sequences ENSNLEP00000013011 ENSNLEP00000013011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]