SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013078 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013078
Domain Number 1 Region: 1046-1336
Classification Level Classification E-value
Superfamily RNI-like 3.01e-42
Family 28-residue LRR 0.017
Further Details:      
 
Domain Number 2 Region: 531-635
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-28
Family Ankyrin repeat 0.0005
Further Details:      
 
Domain Number 3 Region: 132-302
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000197
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 4 Region: 303-433
Classification Level Classification E-value
Superfamily TPR-like 0.000000000195
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 5 Region: 16-138
Classification Level Classification E-value
Superfamily TPR-like 0.000000000759
Family Tetratricopeptide repeat (TPR) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013078   Gene: ENSNLEG00000010719   Transcript: ENSNLET00000013720
Sequence length 1373
Comment pep:novel supercontig:Nleu1.0:GL397529.1:369853:385918:-1 gene:ENSNLEG00000010719 transcript:ENSNLET00000013720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLERELRQLSKAKAKAQRAGQRREEAALCHQLGELLAGHGRYAEALEQHWQELQLRERA
DDPLGCAVAHRKIGERLAEMEDYPAALQHQHHYLELAHSLRNHTELQRAWATIGRTHLDI
YDHCQSRDALLQAQAAFEKSLAIVDEELEGTLAQGELNEMRTRLYLNLGLTFESLQQTAL
CNDYFRKSIFLAEQNHLYEDLFRARYNLGTIHWRAGQHSQAMRCLEGARECAHTMRKRFM
ESECCVAIAQVLQDLGDFLAAKRALKKAYRLGSQKPVQRAAICQNLQHVLAVVRLQQQLE
EAEGSDPQGAMAICEQLGDLFSKAGDFPRAAEAYQKQLRFAELLDRPGAERAIIHVSLAT
TLGDMKDHHGAVRHYEEELRLRSGNVLEEAKTWLNIALSREEAGDAYELLAPCFQKALSC
AQQAQRPQLQRQVLQHLHTVQLRLQPQEAPDTKIRLQELSIAEDEDEEEEAEEAAATAES
EALEAGEVELSESEDDADGMTSQMEEVEELQARLGRRKGSKWNRRNDMGETLLHRCIEGQ
LRRVQDLVRQGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGGQGCEGITP
LHDALNCGHFEVAELLLERGASVTLCTRKGLSPLETLQQWVKLYRRDLDLETRQKARAME
MLLQAAASGQDPHSSQAFHTPSSLLFDPETSPPLSPCPEPPSNSTRPPEASQAHARVSPG
QAAPATARPRRSRHGPASSSSSSEGEDSAGPPRPSQKRSRCSATAQRVAARTPGPASNRE
AVTASTSRAAYQAAIRGVGSAQSRLGPGPLRGQRKALAPQAALIPEEECLAGDWLELDMP
LTRSRRPRPRGTGDNRRPSSTSGSDGEESRPRARAKQVRQSCSVPVKAGPSSLASEPPGS
PSTARASEPSGDSSAAGQPLGPALPPPIRVRVQVQDHLFLIPVPHSSETHSVAWLAEQAA
QRYYQTCGLLPRLTLRKEGALLAPQDLIPDVLQSNDEVLAEVTSWDLPPLTDRYRRACQS
LGQGEHQQVLQAMELQGLGRGEKRCSLALHQAQLTPLLRALKLHTALRELRLAGNRLGDK
CVAELVAALGTMPSLALLDLSSNHLGPEGLRQLAMGLPGQATLQSLEELDLSMNPLGDGC
GQSLASLLHACPLLSTLRLQACGFGPSFFPSHQTALGSAFQDAEHLKTLSLSYNALGAPA
LARTLQRLPARTLLHLELSSVAAGKSDSDFMEPIVRYLAKEGCALAHLTLSANHLGDKAV
GDLCRCLSLCPSLISLDLSANPEISCASLEALLSTLQKRPQGLSFLGLSGCAVQGPLGLG
LWDKIAAQLRELQLCSRLLCAEDRDALRQLQPSRPGPGECTLDHGSKLFFRRL
Download sequence
Identical sequences ENSNLEP00000013078 ENSNLEP00000013078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]