SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013109 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013109
Domain Number 1 Region: 365-579
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.76e-77
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000000024
Further Details:      
 
Domain Number 2 Region: 231-363
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 3.53e-47
Family Domain of poly(ADP-ribose) polymerase 0.000000426
Further Details:      
 
Domain Number 3 Region: 81-206
Classification Level Classification E-value
Superfamily WGR domain-like 7.19e-43
Family WGR domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013109   Gene: ENSNLEG00000010714   Transcript: ENSNLET00000013751
Sequence length 583
Comment pep:novel supercontig:Nleu1.0:GL397514.1:832936:853169:1 gene:ENSNLEG00000010714 transcript:ENSNLET00000013751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMFVAGGKANKD
RTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLN
QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKF
LDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQE
LIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALME
ACNEFYTRIPHNFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQ
HYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKEGEKEAFREDL
HNRMLLWHGSRLSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLK
NTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGP
ASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW
Download sequence
Identical sequences G1RIQ3
XP_003280935.1.23891 ENSNLEP00000013109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]