SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013243 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013243
Domain Number 1 Region: 47-169
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000625
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 
Domain Number 2 Region: 187-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000581
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013243   Gene: ENSNLEG00000010918   Transcript: ENSNLET00000013896
Sequence length 329
Comment pep:novel supercontig:Nleu1.0:GL397310.1:8399979:8416613:1 gene:ENSNLEG00000010918 transcript:ENSNLET00000013896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSIRLLACLACVLPTGECLLLSVARAQDRIDADSILGSPAQRWSMQVPAEVSAAAGDA
AVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGN
PRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGP
AHAFRALCTAEGEPPPALVWSGPALGNGSAAVPNPGQGHGHLVTAELPALTHDGRYTCTA
ASSLGRSEASVYLFRFHGASGASTVALLLGALGLKALLLLGVLAARAARRRPEHLDTPDT
PPRSQAQESNYENLSQMNPRSPPAAMCSP
Download sequence
Identical sequences ENSNLEP00000013243 ENSNLEP00000013243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]