SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013287 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013287
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-38
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-37
Family Link domain 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013287   Gene: ENSNLEG00000010934   Transcript: ENSNLET00000013941
Sequence length 277
Comment pep:novel supercontig:Nleu1.0:GL397370.1:2516794:2539336:1 gene:ENSNLEG00000010934 transcript:ENSNLET00000013941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVLIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYEDNQICYWHIRLKYGQHIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPVSKASQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences G1RJ80
XP_003275006.1.23891 ENSNLEP00000013287 ENSNLEP00000013287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]