SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013595 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013595
Domain Number 1 Region: 264-456
Classification Level Classification E-value
Superfamily Nudix 4.47e-45
Family NADH pyrophosphatase 0.0011
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.83e-20
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013595   Gene: ENSNLEG00000011194   Transcript: ENSNLET00000014269
Sequence length 462
Comment pep:novel supercontig:Nleu1.0:GL397277.1:2273732:2289058:-1 gene:ENSNLEG00000011194 transcript:ENSNLET00000014269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVKRSPKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNATSENGWTALMYAARNGHPE
IVQILLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLATAKDGKKPWFLTNEVEECENY
FSKTLLDRKSEKRNNSDWLLAKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLN
YTDIKDYLAQPEKITLIFLGVELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPTAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKR
VCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR
WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPSL
Download sequence
Identical sequences G1RK38
XP_003259856.1.23891 ENSNLEP00000023891 ENSNLEP00000013595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]