SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013818 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013818
Domain Number 1 Region: 208-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 321-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-23
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 46-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-21
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 4 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 252-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-18
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000688
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013818   Gene: ENSNLEG00000011361   Transcript: ENSNLET00000014497
Sequence length 443
Comment pep:novel supercontig:Nleu1.0:GL397427.1:2191565:2197948:-1 gene:ENSNLEG00000011361 transcript:ENSNLET00000014497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADLVSQEPQALLDSALPSKVPAFSNKDSLGDEMLAAALLKAKSQELVTFEDVAVYF
IRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDI
SQGLKFKEAYEREVSLKRPLGNSPGERLNRKMPDFGQVTVEEKLTPMEERSEKYNDFGNS
FTVNSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQS
SHLIQHQRIHTEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFWSSTLTHH
QRIHTGEKPYAAMNVGRPFSRSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQRIHT
GEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTGEKP
LNGMGMSKSSLRVTTELNIREST
Download sequence
Identical sequences ENSNLEP00000013818 ENSNLEP00000013818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]