SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014442 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014442
Domain Number 1 Region: 499-689
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-46
Family Fibronectin type III 0.0000543
Further Details:      
 
Domain Number 2 Region: 818-1014
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-38
Family Fibronectin type III 0.0000162
Further Details:      
 
Domain Number 3 Region: 296-390
Classification Level Classification E-value
Superfamily Immunoglobulin 9.6e-25
Family I set domains 0.0055
Further Details:      
 
Domain Number 4 Region: 213-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-24
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 400-495
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-21
Family Fibronectin type III 0.0000564
Further Details:      
 
Domain Number 6 Region: 106-193
Classification Level Classification E-value
Superfamily Immunoglobulin 4.42e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 693-787
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-16
Family Fibronectin type III 0.0000095
Further Details:      
 
Domain Number 8 Region: 14-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000383
Family I set domains 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014442   Gene: ENSNLEG00000011879   Transcript: ENSNLET00000015161
Sequence length 1224
Comment pep:novel supercontig:Nleu1.0:GL397310.1:15330110:16066973:1 gene:ENSNLEG00000011879 transcript:ENSNLET00000015161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGFQIKAFTALRFLSEPSDAVTMRGGNVLLDCSAESDRGVPVIKWKKDGIHLALGMDER
KQQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPLRFLSQTES
VTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPDDSRVVVLPSGALQISRLQPGDIG
IYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNIVAIEGKDAVLECCVSGYPP
PSFTWLRGEEVIQLRSKKYSLLGGSNLLISNVTDDDSGMYTCVVTYKNENISASAELTVL
VPPWFLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKNGDVVIPSDYFQIVGGSNLRIL
GVVKSDEGFYQCVAENEAGNAQTSAQLIVPKPAIPSSSVLPSAPRDVVPVLVSSRFVRLS
WRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEW
GPGESSQPIKVATQPELQVPGPVENLQAVSTSPTSVLITWEPPAYANGPVQGYRLFCTEV
STGKEQNIEVDGLSYKLEGLKKFTEYSLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQN
VSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRGEMETLEPNNLWYLFTGLEK
GSQYSFQVSAMTVNGTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPP
LNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPL
YESATTRSITDPTDPVDYYPLLDDFPTSVPDLSTPMLPPVGVQAVALTHDAVRVSWADNS
VPKNQKTSEVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRS
STWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLDK
NIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRTLKVEHPD
KMANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVIIVVTVGV
ITVLVVVIVAVICTRRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKP
SGTDPAGRDSPIQSCQDLTPVSHSQSETQLGSKSTSHSGQDTEEAGSSMSTLERSLAARR
APRAKLMIPMDAQSNNPGESILVP
Download sequence
Identical sequences ENSNLEP00000014442 ENSNLEP00000014442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]