SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014526 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014526
Domain Number 1 Region: 475-753
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.37e-79
Family Protein kinases, catalytic subunit 0.000000000615
Further Details:      
 
Domain Number 2 Region: 197-394
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-32
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 3 Region: 772-841
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 4 Region: 3-62
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-16
Family Ephrin receptor ligand binding domain 0.0000588
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014526
Domain Number - Region: 117-182,228-234
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000549
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014526   Gene: ENSNLEG00000011945   Transcript: ENSNLET00000015250
Sequence length 854
Comment pep:novel supercontig:Nleu1.0:GL397427.1:2827417:2865042:-1 gene:ENSNLEG00000011945 transcript:ENSNLET00000015250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPRQVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLF
YKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGC
SCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSSICQGRIGYFRAHT
DPRRAPCTTPLSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRPGDSYVPC
GGDLTFDLGPQYLVEPWVVVQGLRPDFTYTFEVTALNGVSSLATGPVPFEPVNVTTDREV
PPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAE
LRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVL
VVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVS
YVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEH
PNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAE
MSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPEAIA
FRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLM
LDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFGSVG
EWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAK
PGTPGGTGGPAPQY
Download sequence
Identical sequences ENSNLEP00000014526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]