SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014780 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014780
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 69-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014780
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0961
Family SCAN domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014780   Gene: ENSNLEG00000012178   Transcript: ENSNLET00000015524
Sequence length 534
Comment pep:novel supercontig:Nleu1.0:GL397355.1:5268177:5281591:1 gene:ENSNLEG00000012178 transcript:ENSNLET00000015524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITPPTEAGTWAKLRRPKAATERVALWEDVTEMFKAEALLSQDADETQGESLESR
VTLGSLTAESQELLTFKDVSVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVGYRLSKP
GVISQLEKGEEPWLMERDISGVPSSDLESKTKTKESALQNDISWEELHCGLMMEGSTKGS
TMYSTLGRISKCNKLESQKENQRMDEGQIPLMCKKTFTQERGQKSNRFEKRINAKSEVMP
GPIGLPRKRDRIYDTSGKRSRYNIDLVNHSRSYTKMKTFECNICEKIFKQLIHLTEHMRI
HTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSLTQHVRIHTGE
KPYECRVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQIRHLRQHEIIHTGVKPYI
CNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHC
GKAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRNTFSNVV
Download sequence
Identical sequences A0A2I3HIG2
XP_003273375.1.23891 ENSNLEP00000014780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]