SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014785 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014785
Domain Number 1 Region: 198-347
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-33
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 89-197
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-22
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-22
Family First domain of FERM 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014785
Domain Number - Region: 789-822
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0811
Family Obg GTP-binding protein N-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014785   Gene: ENSNLEG00000012161   Transcript: ENSNLET00000015529
Sequence length 883
Comment pep:novel supercontig:Nleu1.0:GL397271.1:11667871:11987387:1 gene:ENSNLEG00000012161 transcript:ENSNLET00000015529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWL
QLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDS
EVVFELASYILQEAKGDFSSNEVVRSDLKKLPARPTQLKEHPSLAYCEDRVIEHYKKLNG
QTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQ
WRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQHQ
FYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQE
SDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEPP
IVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQR
KTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEMEDS
QVTSTISPLHSPHKGLPPRPPSHNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESSL
DEPYEKVKKRSSHSHSSSHKRFPSTGSCAEAGGGSNSLQNSPIRGLPHWNSQSSMPSTPD
LRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTR
SSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYSTLAEDSPSKTRQRQRQRQRAAGALGSA
SSGSMPNLAARGGAGGAGGAGGGVYLHSQSQPSSQYRIKEYPLYIEGGATPVVVRSLESD
QEGHYSVKAQFKTSNSYTAGGLFKESWRGGGGDEGDTGRLTPS
Download sequence
Identical sequences ENSNLEP00000014785 ENSNLEP00000014785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]