SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014991 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014991
Domain Number 1 Region: 228-380
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.39e-26
Family DnaQ-like 3'-5' exonuclease 0.001
Further Details:      
 
Domain Number 2 Region: 505-663
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.99e-16
Family Canonical RBD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014991   Gene: ENSNLEG00000012334   Transcript: ENSNLET00000015741
Sequence length 774
Comment pep:novel supercontig:Nleu1.0:GL397283.1:7448174:7492694:-1 gene:ENSNLEG00000012334 transcript:ENSNLET00000015741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEREGTETHPRKVRKRRQAPNKLVGAAEAMKAGWDLEESQPEAKKARLSTILFTDNCE
VTHDQLCELLKYAVLGKSNVPKPSWCQLFHQNHLNNVVIFVLQGMSQLHFYRFYLEFGCL
RKAFRHKFRLPPPSSDFLADVVGLQTKQRAGDLRKTMEGPLPSNAKAAINLQNDPIIQKY
GSKKVGLTRCLLTKEEMRTFHFPLQGFPDCENFLLTKCNGSIADNSPLFGLDCEMCLTSK
GRELTRISLVAEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKTL
LPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGRRFKLKFLARVILGKDIQCPDR
LGHDATEDARTILELARYFLKHGPKKIAELNLEALANHQEIQAAGQEPRNTAEVLQHPNT
SVLECLDSVGQKLLFLTQETDAGELPSSRNCQTIKCLSNKEVLEQARVETPLFPFSIVQF
SFKAFSPVLTEEMNKRMRIKWTEISTVYAGPFSKNCNLRALKRLFKSFGPVQSMTFVLET
RQPHLCIQYEVLEAAQLAIESLDGILVDGICIKVQRPVTELTLDCDTLVNELEGDSENQG
SIYLSGVSEAFKEQLLQEPRLFLGLEAVILPKDLKSGKQKKYCFLKFKSFGSAQQALNIL
TGKDWKLKGRHALTPRHLHAWLRGLPPESRRLPGLRVVPPHFEQEALQTLKLDHPKIAAW
RWGRKIGKLYNSLCPGTLCLILLPGTKSTHGSLSGLGLMGIKEEEESAGPGLCS
Download sequence
Identical sequences A0A2I3HTM1
XP_003261510.1.23891 XP_003261511.1.23891 XP_012360857.1.23891 ENSNLEP00000014991 ENSNLEP00000014991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]