SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015048 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015048
Domain Number 1 Region: 39-484
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.84e-98
Family Integrin alpha N-terminal domain 0.000000000751
Further Details:      
 
Domain Number 2 Region: 785-1015
Classification Level Classification E-value
Superfamily Integrin domains 2.98e-65
Family Integrin domains 0.00000498
Further Details:      
 
Domain Number 3 Region: 485-643
Classification Level Classification E-value
Superfamily Integrin domains 1.94e-45
Family Integrin domains 0.0000142
Further Details:      
 
Domain Number 4 Region: 644-778
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-37
Family Integrin domains 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015048   Gene: ENSNLEG00000012372   Transcript: ENSNLET00000015801
Sequence length 1063
Comment pep:novel supercontig:Nleu1.0:GL397271.1:14223522:14423329:-1 gene:ENSNLEG00000012372 transcript:ENSNLET00000015801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPGASRGPRGSQAPLIAPLCCAAAALGMMLWSPASQAFNLDVEKLTVYSGPKDSYFGYA
VDFHIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPSEGSAQCRQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITATVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYTIVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPVIINLENKTCHVPDSMTSAACFSLRVCASVTGQSISNPLVLMA
EVQLDSLKQKGAIKRTLFLDNHQAHRVFPLVIKRQKSHQCQDFIVYLRDETEFRDKLSPI
NISLNYSLDESTFKEGLEVKPILNYYRENVVSEQAHILVDCGEDNLCVPDLKLSARPDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQIN
ITAVVQVEIRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCQTHPNINPQDIKPAASPEDTPELSAFLRNSTIP
HLVRKRDVPVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQ
RKNDPYALASLVSFEVKKMPYKDQPAKLPEGSIAIKTSVIWATPNVSFSIPLWVIILAIL
LGLLVLAILTLALWKCGFFDRARPPQEDMTDREQLTNDKTPEA
Download sequence
Identical sequences ENSNLEP00000015048 ENSNLEP00000015048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]