SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015106 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000015106
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily FnI-like domain 0.00293
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015106   Gene: ENSNLEG00000012445   Transcript: ENSNLET00000015861
Sequence length 289
Comment pep:novel supercontig:Nleu1.0:GL397282.1:19235989:19251444:-1 gene:ENSNLEG00000012445 transcript:ENSNLET00000015861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTVRCQSQRCSPLSCGPDKAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQ
GSCSYVLAKDCHGGDFSVHVTNDDRGRSGVACTQVAVLLGDVAVRLLQDGAVTVDGRLVA
LPFLQEPLLYVELRGHTVILHTQPGLQVLWDGQSQVEVSVPGSYQGRTCGLCGNFNGFAQ
DDLQGPEGLLLPTEAAFGNSWQVQEGRGCPPGLELPTVLLQMERSRQAQEQLLWDLELLT
GVELGLFWPPQAQFFGPRGQAQHACQPGGSMGGDPEQPILKAGCDGSCL
Download sequence
Identical sequences ENSNLEP00000015106 ENSNLEP00000015106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]