SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015184 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015184
Domain Number 1 Region: 54-221
Classification Level Classification E-value
Superfamily PUA domain-like 8.29e-58
Family Atu2648/PH1033-like 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015184   Gene: ENSNLEG00000012493   Transcript: ENSNLET00000015941
Sequence length 225
Comment pep:novel supercontig:Nleu1.0:GL397521.1:358352:363436:-1 gene:ENSNLEG00000012493 transcript:ENSNLET00000015941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKTCSKNLSSHWLMK
SEPESRLEKGVDVKFSIEDLKAQPRQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKE
PGIAGIMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKS
YHQAHKATGGPLKNMVLFTRQRLSVQPLTQEEFDFVLGLEEKEPS
Download sequence
Identical sequences G1RPM0
XP_003281048.1.23891 XP_003281049.1.23891 ENSNLEP00000015184 ENSNLEP00000015184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]