SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015796 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015796
Domain Number 1 Region: 395-618
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.19e-75
Family ATP sulfurylase catalytic domain 0.00000000119
Further Details:      
 
Domain Number 2 Region: 225-392
Classification Level Classification E-value
Superfamily PUA domain-like 1.39e-52
Family ATP sulfurylase N-terminal domain 0.0000000237
Further Details:      
 
Domain Number 3 Region: 34-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.06e-41
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015796   Gene: ENSNLEG00000012992   Transcript: ENSNLET00000016601
Sequence length 624
Comment pep:novel supercontig:Nleu1.0:GL397271.1:24183390:24292862:1 gene:ENSNLEG00000012992 transcript:ENSNLET00000016601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGL
SGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLF
ADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAG
EIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVP
ENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGG
VINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTC
KNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL
RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGV
LNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPS
HGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQK
PPEGFMAPKAWTVLTEYYKSLEKA
Download sequence
Identical sequences A0A2I3HQ83 K7CTZ2 O43252
NP_005434.4.87134 NP_005434.4.92137 XP_003257787.1.23891 ENSP00000265174 ENSNLEP00000015796 ENSP00000265174 ENSNLEP00000015796 9606.ENSP00000265174 gi|46094058|ref|NP_005434.4| ENSP00000265174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]