SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016034 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016034
Domain Number 1 Region: 112-195
Classification Level Classification E-value
Superfamily Immunoglobulin 3.52e-17
Family I set domains 0.0000072
Further Details:      
 
Domain Number 2 Region: 26-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000022
Family I set domains 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016034   Gene: ENSNLEG00000013227   Transcript: ENSNLET00000016854
Sequence length 257
Comment pep:novel supercontig:Nleu1.0:GL397275.1:9823275:9829106:1 gene:ENSNLEG00000013227 transcript:ENSNLET00000016854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAMESPTLLCVALLFFAYFYLLEVPQKPMVSLNPPWNRIFKGENVTLTCNGNNFFEVS
STKWFHNGSLSEETNSSLNIVNASFEDSGEYKCQHQQVKESEPVYLEVFSDWLLLQASAE
VVMEGQPLFLRCHGWRNWDVYKVIYYKDGDALKYWYENHNISITNATVEDSGTYYCTGKV
WQLDYESEPLNITVIKARHGKYWLQFFIPLLVAILFAVDTGLFISTQQQVTFLLKIKRTR
KGFKLLNPHPKPNPKSN
Download sequence
Identical sequences ENSNLEP00000016034 ENSNLEP00000016034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]