SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016095 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016095
Domain Number 1 Region: 148-256
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000197
Family I set domains 0.023
Further Details:      
 
Domain Number 2 Region: 31-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000156
Family V set domains (antibody variable domain-like) 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016095   Gene: ENSNLEG00000013290   Transcript: ENSNLET00000016916
Sequence length 331
Comment pep:novel supercontig:Nleu1.0:GL397275.1:10335678:10342341:-1 gene:ENSNLEG00000013290 transcript:ENSNLET00000016916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVGGAFHLLLVCLSPALLSAVRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDI
EWMQVNSDPAHHRENVFLSYQDKRINHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSD
TATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYANGGSQPLSYKW
AKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCT
VANNVGYSVCVVEVKVSDSRRIGMIIGAVLGSLLALGCLAVGIWGLVCCCCGGSGAGGAR
GAFGYSNGGRVGGGACGDLASEIRNLMHAAC
Download sequence
Identical sequences ENSNLEP00000016095 ENSNLEP00000016095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]