SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017374 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017374
Domain Number 1 Region: 3873-4066
Classification Level Classification E-value
Superfamily Fibronectin type III 5.67e-38
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 2 Region: 4529-4735
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-35
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 4268-4443
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-34
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 1242-1288,1319-1452
Classification Level Classification E-value
Superfamily Fibronectin type III 8.69e-34
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 4732-4932
Classification Level Classification E-value
Superfamily Fibronectin type III 1.06e-31
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 6 Region: 1054-1243
Classification Level Classification E-value
Superfamily Fibronectin type III 2.71e-30
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 7 Region: 1519-1683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-30
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 8 Region: 2531-2673
Classification Level Classification E-value
Superfamily Fibronectin type III 3.49e-30
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 9 Region: 1707-1895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.65e-29
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 2142-2329
Classification Level Classification E-value
Superfamily Fibronectin type III 6.72e-29
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 11 Region: 2329-2533
Classification Level Classification E-value
Superfamily Fibronectin type III 4.48e-28
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 12 Region: 2819-3005
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-27
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 13 Region: 3589-3719
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-27
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 14 Region: 1982-2143
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-26
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 15 Region: 3688-3867
Classification Level Classification E-value
Superfamily Fibronectin type III 3.82e-25
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 16 Region: 3450-3587
Classification Level Classification E-value
Superfamily Fibronectin type III 5.85e-24
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 17 Region: 2688-2821
Classification Level Classification E-value
Superfamily Fibronectin type III 6.86e-22
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 18 Region: 3020-3149
Classification Level Classification E-value
Superfamily Fibronectin type III 1.5e-20
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 19 Region: 4023-4155
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-20
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 20 Region: 123-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-17
Family Pentraxin (pentaxin) 0.087
Further Details:      
 
Domain Number 21 Region: 4149-4264
Classification Level Classification E-value
Superfamily Fibronectin type III 5.35e-17
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 22 Region: 1424-1508
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000189
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 23 Region: 4436-4539
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000947
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 24 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 25 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 26 Region: 900-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 27 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 28 Region: 747-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 29 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 30 Region: 575-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 31 Region: 1906-1959
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000197
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 32 Region: 1002-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 33 Region: 951-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017374
Domain Number - Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 337-415
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00267
Family beta-mannanase CBM 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017374   Gene: ENSNLEG00000014249   Transcript: ENSNLET00000018241
Sequence length 5226
Comment pep:novel supercontig:Nleu1.0:GL397299.1:6694347:7519635:1 gene:ENSNLEG00000014249 transcript:ENSNLET00000018241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCPVLSLGSGFLFQVIEMLIFVYFASISLAESRGLFPRLENVGAFKNVSIVPTQAVCGL
PDRSTFCHSSAAAESIQFCTQRFCIQDCPYRSSHPTYTALFSAGLSGCITPDKNDLHPNS
HSNSTSFIFGNHKNCFSSPPSPRLMASFTLAVWLKPEQQGVMCVIEKTVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFINGVEKDHTPFDAR
TLSGSITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQS
HCRCPGSHPRVHPLAQRYCIPNDAGDTADNRVSRLNSEAHPLSFVNDNDVGTSWVSNVFT
NVTQLNQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSSDWEDWQYFARNCG
AFGMKNNGGLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNDFYNTPSLQEFV
KATQIRFHFHGQYYTTETAVNLRHRYYAVDEITISGRCQCHGHADNCDTTSQPYRCLCSQ
ESFTEGLHCDRCLPLYNDKPFRQGDQVHAFNCKPCQCNSHSKSCHYNISVDPFPSEHFRG
GGGVCDDCEHNTTGRNCELCKDYFFRQVGADPLAIDVCKPCDCDKVGTRNGSILCDQIGG
RCNCKRHVSGRQCNQCQNGFYNLRELDPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKAN
VIGLRCDRCNFGFKFLRSFNNDGCEPCQCNLHGSVNKFCNPLSGQCECKKEAKGLQCDTC
RENFYGLDVTNCKACDCDTAGSLPGTVCNAKTGQCICKPNVGGRQCNKCLEGNFYLRQNN
SFLCLPCNCDKTGTTNGSLLCDKSTGQCPCKLGVTGLRCNQCEPHRYNLTIDNFQRCQMC
ECDSLGTLPGTICDPISGQCLCVPNRQGRRCNQCQPGFYISPGNATGCLPCSCHTTGAVN
HICNSLTGQCVCQDDSIAGQRCDQCKDHYFGFDPQTGRCQPCNCHLSGALNETCHLVTGQ
CFCKQFVTGSKCDACVPSASHLDVNNLLGCSKTPFQQPPPRGKVQSSSAINLSWSPPDSP
NAHWLTYSLLRDGFEIYTTEDQYPYSIQHFLDTDLLPYTKYSYYIETTNVHGSTRSVAVT
YRTKPGVPEGNLTLSYIIPIGSDSVTLTWTTLSNQSGPIEKYILSCAPLAGGQPCVSYEG
HETSATIWNLVPFAKYNFSIQACTSGGCLHSLPIAVTTAQAPPQRLSPPKVQKISSTELH
VEWSPPEELNGIIIRYELYMRRLRSTKEATSEESRIFQSSGWLSPHSFVESANENALKPP
QTMTTITGLEPYTKYEFRVLAVNMAGSVSSAWVSERTGESAPVFMIPPSVFPLSSYSLNI
SWEKPADNVTRGKVVGYDINMISEQSPQQSIPVAFSQLLHTAKSQELSYTVEGLKPYRIY
EFTITVCNSVGCVTSASGAGQTLAAAPAQLRPPLVKGINSTTIHLRWFPPEELNGPSPMY
QLERRESSLPARMTTMMKGIRFTGNGYCKFPSSTHPVNTDFTGIKASFRTKVPEGLIVFA
ASPGNQEEYFALQLKKGRLYFLFDPQGSPVEVTTTNDHGKQYSDGKWHEIIAIRHQAFGQ
ITLDGIYTGSSAILNGSTVIGDNTGVFLGGLPRSYTILRKDPEIIQKGFVGCLKDVHFMK
NYNPSAIWEPLDWQSSEEQINVYNSWEGCPASLNEGAQFLGAGFLELHPYMFHGGMNFEI
SFKFRTDQLNGLLLFVYNTDGPDFLAMELKSGILTFRLNTSLAFTQVDLLLGLSYCNGKW
NKVIIKKEGSFISASVNGLMKHASESGDQPLVVNSPVYVGGIPQELLNSYQHLCLEQGFG
GCVKDVKFTRGAVVNLASVSSGAVRVNLDGCLSTDSAVNCRGNDSILVYHGKEQSVYEGG
LQPFTEYLYRVIASHEGGSVYSDWSRGRTTGAAPQSVPTPSRVRSLNGYSIEVTWDEPVV
RGVIEKYILKAYSEDSTHPPHMPSASAEFVNTSTLTGILTGLLPFKNYAVTLTACTLAGC
TESSHALNISTPQEAPQEVQPPVAKSLPNSLLLSWNPPKKANGIITQYCLYMDGRLIYSG
NEENYTVTDLAVFTPHQFLLSACTHVGCTNSSWVLLYTAQLPPEHVDSPILTVLDSRTIY
IQWKQPRKISGILERYILYISNDTHDFTIWSVIYNSTELFQDHMLQYLLPGNKYLIKLGA
CTGGGCTVSEASEALTDEDIPEGVPAPKAHSYSPDSFNVSWTEPEYPNGVITSYGLYLDG
ILIHNSSELSCHAYGFAPWSLHSFRVQACTAKGCALGPLVENRTLEAPPEGTVNVFVKTQ
GSRKAHVRWEAPYRPNGLLTYSVVFTGIFYVDPVGNNYTLLNVTKVMYSGEETNLWVLID
GLVPFTNYTVQVNISNSQGSLITDPITIAMPPGAPDGVLPPRLSSATPTSLQVVWSTPAR
NNAPGSPRYQLQMRSGDSTRGFLELFSNPSASLSYEVSDLQPYTEYMFRLVASNGFGSAH
SSWIPFMTAEDKPGPVVPPILLDVKSRMMLVTWKHPRKSNGVITHYNVYLHGRLYLRTPG
NVTNCTVMHLHPYTAYKFQVEACTSKGCSLSPESQTVWTLPGAPEGIPSPELFSDTPISV
IISWQPPTHPNGLVENFTIERRVKGKEEVTTLVTLPRSHSMRFIDKTSSLSPWTKYEYRV
LMSTLHGGTNSSAWVEVTTRPSRPAGLQPPVVTVLEPDAVQVTWKPPLIQNGDILSYEIR
MPDPHITITNVTSTVLSQKVTHLIPFTNYSVTIVACSGGNGYLGGCTESLPTYVTTHPTV
PQNVGPLSVIPLSESYVVISWQPPSKPNGPNLRYELLRRKIQQPLASNPPEDLNRWHNIY
SGTQWFYEDKGLSRFTTYEYMLFVHNSVGFTPSQEVTVTTLAGFPERGANLTASVLNHTA
IDVGWAKPTVQDLQGEVEYYTLFWSSATSNDSLKILPDVNSHVIGHLKPNTEYWIFISVF
NGVHSINSAGLHATTCDGEPQGMLPPEVVIINSTAVRVIWTSPSNPNGVVIEYSIYVNNK
LYKTGMNVPGSFILRDLSPFTIYDIQVEVCTIYACVKSNGTQITTVEDTPSDIPTPTIRG
ITSRSLQIDWVSPQKPNGIILGYDLLWKTWYPCPKTQKLVQDQSDELCKAVRCQKPEYIC
GHICYSPEAKVCCNGVLYNPKPGHRCCEEKYIPFVLNSTGVCCGGRIQEAQPNHQCCSGY
YARILPGEVCCPDEQHNRVSVGIGDSCCGRMPYSTSGNQICCAGRLHDGHGQKCCGRQIV
SNDLECCGGEEGVVYNRLPGMFCCGQDYVNMSDTICCSASSGESKAHVKKNDPVPVKCCE
TELIPKSQKCCNGVGYNPLKYVCSDKISTGMMMKETKECRTLCPASMEATAHCGRCDFNF
TSQICTVIRGSHNSTGKASIEEMCSSAEETIHTGSVNTYSYTDVNLKPYMTYEYRISAWN
SYGRGLSKAVRARTKEDVPQGVSPPTWTKIDNLEDTIVLNWRKPIQSNGPIIYYILLRNG
IERFRGTSLSFSDREGIQPFQEYSYQLKACTVAGCATSSKVVAATTQGVPESILPPSITA
LSAEALHLSWSVPEKPNGVIKEYQIRQVGKGLIHTDTTDRRQHTVTGLQPYTNYSFTLTA
CTSAGCTSSEPFLGQTLQAAPEGVWVTPRHIIINSTTVELYWSLPEKPNGLISQYQLSRN
GNLLFLGGSEEQKFTDKNLEPNSRYTYKLEVKTGGGSSTSDDYIVQTPLSTPEEIYPPYN
ITVIGPYSIFVAWIPPGILIPKIPVEYNVLLNDGSVTPLAFSVGPHQSTLLENLAPFTQY
EIRIQACQNGGCGVSSRMFVKTPEAAPVDLNSPVLKALGSASIEIKWMPPEKPNGIIINY
FIYRRPAGIEEESLLFVWSEGALEFIDEGDTLRPFTLYEYRVRACNSKGSVESLWSLTRT
LEAPPQDFPAPWAQATSAHSVLLNWTKPESPNGIISHYRVVYQERPDDPTFNSPAVHAFT
VMGTSHQAHLFGLEPFTTYRIGVVAANHAGEILSPWTLIQTLESSPSGLRNFIVEQKENG
RALLLQWSEPMRTNGVIKTYSIFSDGLLEYSGLNRQFLFRRLDPFTLYTLTLEACTTAGC
AHSAPQPLWTDEAPPDSQLAPTAHSVKSTSVELSWSEPVNPNGKIIRYEVIRRCFEGKAW
GNQTIQANEKIVFTEYNTERNTFMYNDTGLQPWTQCEYKICTWNSAGHTCSSWNVVRMSQ
APPEGLSPPVISYVSMNPQKLLISWIPPEQSNGIIQSYRLQRNEMLYPFSFDAVTFNYTD
EELLPFSTYSYALQACTSGGCSTSKPTSITTLEAAPSGVSPPDLWAISATQINVSWSPPA
VQNGKITKYLVRYDNKESLAGQGLCLLVSHLQPYTQYNFSLVACTNGGCTASVSKSAWTM
EALPENMDSPTLQVTGSESIEITWKPPRNPNGQIRSYELRRDGTIVYTGLETRYHDFTLT
PGVEYGYTVTANNSQGGILSPLVKDRTSPSAPSGMEPPKLQARGPQEILVNWDPPVRTNG
DIINYTLFIRELFERETKIIHINTTHNSFGTQSYIVNQLKPFHRYEIRIQACTTLGCASS
DWTFIQTPEIAPLMQPPPHLEVQMAPGGFQPTVSLLWTGPLQPNGKVLYYELYRRQMATQ
PGKSNPVLIYNGSSTSFIDSELLPFTQYEYQVWAVNSAGKAPSSWTWCRTGPAPPEGLRA
PTFHAISSTQAVVNISAPGKPNGIISLYRLFSSSIHGAETVLSEGMATQQTLHGLQAFTN
YSIGVEACTCFNCCSKGPTAELRTHPAPPSGLSSPQIETLASRMASFQWSPPMFPNGVIY
SYELQLHVACPPDSALPCTPSQIETKYTGLGQKASLGGLQPYTTYKLRVVAHNEVGSTAS
EWISFTTQKELPQYRAPFSVDSNLSVVCVNWSGTFLLNGQLKEYVLTDGGRRVYSGFDTT
LYIPRTADKTFFFQVICTTDEGSVKTPLIQYDTSTGLGLVLTTPGEKKGSRSKSTEFYSE
LWFIVLMAMLGLILLAIFLSLILQRKIHKEPYIRERPPLVPLQKRMSPLNVYPPGENHIF
DSVADISDVSSNVTLKSYTMHFEGLADTKIIRSGTPVSIHSNRSACVLRIPSQSQTSLTY
SQGSLHRSVSQLMDVQDKKVLMDDSLWEAIMGHNSGLYVDEEDLMNAIKGFSSVTKERTT
FTDTHL
Download sequence
Identical sequences ENSNLEP00000017374 ENSNLEP00000017374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]