SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017502 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017502
Domain Number 1 Region: 120-205
Classification Level Classification E-value
Superfamily Immunoglobulin 8.96e-16
Family I set domains 0.0000109
Further Details:      
 
Domain Number 2 Region: 38-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000185
Family I set domains 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017502   Gene: ENSNLEG00000014397   Transcript: ENSNLET00000018373
Sequence length 317
Comment pep:novel supercontig:Nleu1.0:GL397275.1:11916160:11929222:1 gene:ENSNLEG00000014397 transcript:ENSNLET00000018373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMETLMSQNVRPCNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLREDSVTL
TCRGAHSPESDSTQWFHNGNLIPTYTQPSYRFKANNNDSGEYRCQTGQTSLSDAVHLTVL
SEWLVLQTPHLEFQEGETIMLRCHSWKDRPLVKVTFFQNGKSKKFSRLDPNFSIPQANHS
HSGDYHCTGNIGYVLYSSKPVTITVQAPSVGSSSPMGIIVAVVTVTAVVAIVAAVVALIY
CRKKRISANSTDSVKAAQFELPGRQMIAIRKRQLEETNNDYEIADGGYMTLNPRAPTDDD
KNIYLTLPPNDHVNSNN
Download sequence
Identical sequences G1RW75
ENSNLEP00000017502 ENSNLEP00000017502 XP_004089886.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]