SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017797 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017797
Domain Number 1 Region: 128-335
Classification Level Classification E-value
Superfamily TPR-like 1.21e-23
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number 2 Region: 10-43,72-159
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000336
Family Tetratricopeptide repeat (TPR) 0.0065
Further Details:      
 
Domain Number 3 Region: 349-407
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000137
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017797   Gene: ENSNLEG00000014627   Transcript: ENSNLET00000018685
Sequence length 412
Comment pep:novel supercontig:Nleu1.0:GL397449.1:1560407:1570650:-1 gene:ENSNLEG00000014627 transcript:ENSNLET00000018685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYK
EMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQ
LGGQVSLSMGNAFLGLSVFQKALESFEKALRYAHNSDDAMLECRVCCSLGSFYAQVKDYE
KALFFPCKAAELVSNYGKGWSLKYRAMSQYHMAVAYRLLGHLGSAMECCEESMKIALQHG
DRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVSRK
ALDKALDAIERAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETE
LYCGLCGESIGEKNSRLQALPCSHIFHFRCLQNNGTRSCPNCRRSSMKPGFV
Download sequence
Identical sequences G1RX20
ENSNLEP00000017797 ENSNLEP00000017797 XP_003279022.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]