SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017965 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017965
Domain Number 1 Region: 273-308
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000000000000036
Family Leucine zipper domain 0.0004
Further Details:      
 
Domain Number 2 Region: 240-275
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 0.0000000523
Family A DNA-binding domain in eukaryotic transcription factors 0.006
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017965
Domain Number - Region: 192-257
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.068
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017965   Gene: ENSNLEG00000014776   Transcript: ENSNLET00000018859
Sequence length 328
Comment pep:novel supercontig:Nleu1.0:GL397299.1:14382226:14383778:-1 gene:ENSNLEG00000014776 transcript:ENSNLET00000018859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPHVGLLKLAPELERLIIHSCKHFEERPSGAEGQRRKKITQRDRLENLTSCDGEKKEV
QGYPSWTGLRPDGAPKLHGPNIRSHSVLKGGGGGDCRLLLEPPVYANLSNFNPGALSSGG
GAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPL
SPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLR
EQVAQIKQVMNHVNSGCQLMLTQQLQTF
Download sequence
Identical sequences ENSNLEP00000017965 ENSNLEP00000017965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]