SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018006 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018006
Domain Number 1 Region: 36-505
Classification Level Classification E-value
Superfamily Sema domain 4.84e-148
Family Sema domain 0.00000000866
Further Details:      
 
Domain Number 2 Region: 508-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000157
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 573-641
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000485
Family I set domains 0.039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018006
Domain Number - Region: 714-723
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018006   Gene: ENSNLEG00000014804   Transcript: ENSNLET00000018901
Sequence length 787
Comment pep:novel supercontig:Nleu1.0:GL397265.1:34533149:34547919:1 gene:ENSNLEG00000014804 transcript:ENSNLET00000018901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRLWPLLLSILTATAVPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLL
LEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNSTHLYACGTHAFQPLCAAIDAEAFTLPSSFEEGKEKCPYDPARGFTGLIIDGGL
YTATRYEFRSIPDIRRSRHPHSLRTEETPMHWLNDAEFVFSVLVWESKASAVGDDDKVYY
FFTERATEEGSGSFTQSRSSHRVARVARVCKGDLGGKKILQKKWTSFLKARLICHIPLYE
TLRGVCSLDAETSSRTHFYAAFTLSTQWSTLEASAICRYDLAEIQAVFAGPYMEYQDGSR
RWGRYEGGVPEPRPGSCITDSLRSQGYNSSQDLPSLVLDFVKLHPLMARPIVPTRGRPLL
LKRNVRYTHLTGTPVTTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQVFREPQSV
ENLVISLLQHSLYVGAPTGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACTAATTI
ANRSQGSRTALIQDIERGNRGCESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALW
LLNGSMGLSDEQGGYRVGVDGLLVTDAQPEHSGNYGCYAEENGLRTLLASYSLRRGRRRK
YSLGRASRAGGSAVQLQTVSGQCPGEEDEGDDEGAGGLEGSCLQIIPGEGAPAPPPPPPP
PPPAELTNGLVALPSRLRRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRKHTQLVE
QLDESSV
Download sequence
Identical sequences ENSNLEP00000018006 ENSNLEP00000018006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]