SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018017 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018017
Domain Number 1 Region: 88-214
Classification Level Classification E-value
Superfamily Lysozyme-like 4.44e-48
Family C-type lysozyme 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018017   Gene: ENSNLEG00000014819   Transcript: ENSNLET00000018913
Sequence length 215
Comment pep:novel supercontig:Nleu1.0:GL397288.1:4776333:4782101:1 gene:ENSNLEG00000014819 transcript:ENSNLET00000018913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVSALQGAPLIRVHSSPVSSPSVSAPRRLLSCLSSQSSAVGQSGGGSTSAAGIEARSRAL
GRRWCPAGIMLLALVSLLSCLLPSSEAKVYSRCELARVLHDFGLDGYRGYSLADWVCLAY
FTSGFNTAAVDHEADGSTNNGIFQINSRRWCRNLTPNVPNLCRMYCSDLLNPNLKDTVIC
AMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF
Download sequence
Identical sequences ENSNLEP00000018017 ENSNLEP00000018017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]