SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018268 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018268
Domain Number 1 Region: 119-323
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.42e-59
Family Myotubularin-like phosphatases 0.000019
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-19
Family GRAM domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018268   Gene: ENSNLEG00000015029   Transcript: ENSNLET00000019177
Sequence length 324
Comment pep:novel supercontig:Nleu1.0:GL397337.1:10161904:10189812:1 gene:ENSNLEG00000015029 transcript:ENSNLET00000019177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELFSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQARAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLE
ASNWLTHIKEILTTACLAAQCIDR
Download sequence
Identical sequences ENSNLEP00000018268 XP_003271480.1.23891 ENSNLEP00000018268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]