SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018693 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018693
Domain Number 1 Region: 718-775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000248
Family Somatomedin B domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018693   Gene: ENSNLEG00000015409   Transcript: ENSNLET00000019630
Sequence length 809
Comment pep:novel supercontig:Nleu1.0:GL397584.1:96481:116195:1 gene:ENSNLEG00000015409 transcript:ENSNLET00000019630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTAQASALLSITALGPGPSSPPDAQESCSMRCGTLGGPCSCHPTCSGLGTCCLDFRDFCL
ETLPYSGSMMGGKDFVVRRFKMSSPTDTSVICRPQESIQILSHVDSSGQVHFVSPLLYES
GRIPFIISLDNGHSFPHAGTWLAVHPNKVLMIEKSELVNEMLWQYYGTADTSGNLSLTWH
IEALLMQTVTIELWGYEETGMPYSQEWTAKWSHLYPLATHIPNSGSFTFTPKPAPPSYQR
WRVGALRIIDSKNYAGQRDVQAHWTNDHALAWHPSDDFLEDLVAAHTQCQAWEELEEQLP
SFLEELPDCPCTLTQAQADSGRFFRDYGCDMEQGSVCTYHPGAVHCVGSVQARLHSRRGQ
HCCYTADGVQLLTADSSSSSTPNIGHDWGAPPFRMPPVPSMSHWLYDVLSFYYCCLWAPG
CPRYMQRQPSNDCRNYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAVLTDLRVQA
RAQPGTLSNGTETHGTGLTTVAIQEGNSDVVEVRLANRTRGLEVLLNQKVLSFAEQSWMD
LKGMFLSVAAGDRVSIMLASGAGLEVSMQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTD
DFILRSGRVLPPGTSPQELFQFGADWAVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLF
PGETTINPSLAQEAAKLCGDDHFCNFDVAATGSLSTGNATRVAHQLHQRHMRSLQPVVSC
GWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETSTCQADGTWSSPTPKCQPGRSYA
VLLGIIFGGLAVVAAVALVYVLLRRRKGN
Download sequence
Identical sequences ENSNLEP00000018693 ENSNLEP00000018693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]