SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019177 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019177
Domain Number 1 Region: 44-809
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-277
Family Motor proteins 0.000000000221
Further Details:      
 
Domain Number 2 Region: 1192-1294
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000758
Family Ubiquitin-related 0.042
Further Details:      
 
Domain Number 3 Region: 1286-1379
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000171
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 4 Region: 1792-1849
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000191
Family Ras-binding domain, RBD 0.032
Further Details:      
 
Domain Number 5 Region: 1504-1567
Classification Level Classification E-value
Superfamily SH3-domain 0.000000173
Family SH3-domain 0.0027
Further Details:      
 
Domain Number 6 Region: 816-882
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000404
Family Motor proteins 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019177   Gene: ENSNLEG00000015810   Transcript: ENSNLET00000020146
Sequence length 1961
Comment pep:novel supercontig:Nleu1.0:GL397388.1:4873388:4947524:1 gene:ENSNLEG00000015810 transcript:ENSNLET00000020146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFRLGDHVWLEPPSTHKTGVAIGGIIKETKPGKVLVEDDEGKEHWIRAEDFGVLSPMH
PNSVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQ
LYYSRHMGELPPHVFAVANNCYFNMKRNKRDQCCIISGESGAGKTETTKLILQFLATVSG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLMGMSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAH
IRSAMKILQFSDSESWDLTKLLAAILHLGNVGFMASVFENLDASDVMETPAFPTVMRLLE
VQHQELQDCLIKHTILIRGEFVTRPLNVAQAADRRDAFVKGIYGHLFLWIVKKINAAIFT
PPAQDPKNVRRAIGLLDIFGFENFKNNSFEQLCINFANEHLQQFFVQHVFTMEQEEYHSE
NISWDYIHYTDNRPTLDLLALKPMSIISLLDEESRFPQGTDLTMLQKLNSVHASNKAFLQ
PKDIHSARFGIAHFAGEVYYQAEGFLEKNRDMLSTDILTLVYSSKNKFLREIFNLELAET
RLGHGTIRQAKAGNHLFKSADSNKRPSTLGSQFKQSLDQLMKILTNCQPYFIRCIKPNEY
KKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYTFEEFSQRFGVLLPNAVRMQLQGKF
RQMTLGITDMWLRTDKDWKVGKTKIFLKDHQDTLLEVQRSQVLDRAALSIQRVLRGYRYR
KEFLRQRRAAVTLQAWWRGYCNRRNFKLILVGFERLQAIARSQLLARQYQAMRQRTVQLQ
ALCRGYLVRQQVQTKRRAVVVIQAHARGMAARRNFQQRKASAPLVIPAEGQKSQGALPAK
KRRSIYDTVTDTEMVEKVFGFLPAMIGGQEGQAPPRFEDLESKTQKLLEVDLDTVPMAEE
PEEDVDGLAEYTFPKFAVTYFQKSASHTHIRRPLRYPLLYHEDDTDCLAALVIWNVILRF
MGDLPEPVLYARSSQQGSSVMQQIHDTLGREHGAQVPQHSRSAQVASQLNTGEEALEPDG
LGADRPMSNLEKVHFIVGYAILRPSLRDEIYCQICKQLSENFKTSSLARGWILLSLCLGC
FPPSERFMKYLLNFIGQGPANYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKKHIPIQ
VILATGESLTVPVDSASTSREMCMHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGRDHMMD
AIAQCEQLAQERGESQRQSPWRIYFRKEFFTPWHDSQEDPISTELIYRQVLHGVWSGEYS
FEKEEELVELLARHCYVQLGASAESKAVQELLPSCIPHKLYRTKPPDRWASLVTAACAKA
PYTQRQATPLAVREQVVDAARLQWPLLFSRLFEVITLSGPRLPKTQLILAVNWKGLCFLD
QREKMLLELSFPEVMGLATNREAQGGQRLLLSTMHEEYEFVSPSSVAITELVALFLEGLK
ERSVFAMALQDRKATDDATLLAFKKGDLLVLTKKQGLLASENWTLGQNDRTGKMGLVPTA
CLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFSEPRPEEPPKEKPHTLEEFSYEFFR
APEKDIVSMAVLPLARARGHLWAYSSEPLRQPLLKRVHANVDLWDIACQIFVAILRYMGN
YPSRQAWPTLELTDQIFTLALQHPALQDEVYCQILKQLTHNSNRHSEERGWQLLWLCTGL
FPPSKGLLPHAQKFIDTRRGKLLAPVCSRRIQRVLRTGPRKQPPHQVEVEAVEQNVSRIC
HKIYLPNDTSEMLEVVANTRVRDVCDSIATRLQLASWEGCSLFIKIADKVGLAGAGQTAG
GQAVSGALGAAWGGLSLPGAPMLNQAARPGLLEVGGVLEQSQLHTPIAHAQPTPVQHPGH
RRPLDQSPAGTSQEDSPQKPPDFPVPSPSPGHQPEGGRLLL
Download sequence
Identical sequences ENSNLEP00000019177 ENSNLEP00000019177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]