SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019319 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019319
Domain Number 1 Region: 132-303
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.7e-42
Family Mitochondrial carrier 0.00025
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000454
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019319   Gene: ENSNLEG00000015935   Transcript: ENSNLET00000020293
Sequence length 303
Comment pep:novel supercontig:Nleu1.0:GL397554.1:532438:538532:-1 gene:ENSNLEG00000015935 transcript:ENSNLET00000020293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGI
SISLEQAEKILHRTQQDSSGVSKQESLADSILGFIEETPLFSTESHLPVLDIGECLTVPD
EFSKQEKLTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMV
LEGGVRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGLAAHQSN
AISCSPQVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLA
VYE
Download sequence
Identical sequences ENSNLEP00000019319 ENSNLEP00000019319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]