SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019428 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000019428
Domain Number - Region: 36-89
Classification Level Classification E-value
Superfamily FnI-like domain 0.00303
Family Fibronectin type I module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019428   Gene: ENSNLEG00000016023   Transcript: ENSNLET00000020410
Sequence length 114
Comment pep:novel supercontig:Nleu1.0:GL397429.1:2515733:2530400:-1 gene:ENSNLEG00000016023 transcript:ENSNLET00000020410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVLVGSLVIFTTFVTLCNASCYFIPNERVAGDSTRECMDLEGNKHPINSEWQTDNCETC
TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Download sequence
Identical sequences G1S1P0
ENSNLEP00000019428 ENSNLEP00000019428 XP_003278237.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]