SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019879 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019879
Domain Number 1 Region: 197-300
Classification Level Classification E-value
Superfamily EF-hand 8.55e-29
Family Osteonectin 0.018
Further Details:      
 
Domain Number 2 Region: 285-378
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.01e-22
Family Thyroglobulin type-1 domain 0.00062
Further Details:      
 
Domain Number 3 Region: 134-179
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019879   Gene: ENSNLEG00000016379   Transcript: ENSNLET00000020877
Sequence length 423
Comment pep:novel supercontig:Nleu1.0:GL397335.1:6300859:6330130:-1 gene:ENSNLEG00000016379 transcript:ENSNLET00000020877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNR
FRDVLDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHRI
KQPTVKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPCP
CPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVASPASGLDKS
LGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVSTAE
XXXXXXXXXPPCLAELERVQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQL
GLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDGG
YIW
Download sequence
Identical sequences ENSNLEP00000019879 ENSNLEP00000019879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]