SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020317 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020317
Domain Number 1 Region: 1144-1339
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 934-1057
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-32
Family Pleckstrin-homology domain (PH domain) 0.00000049
Further Details:      
 
Domain Number 3 Region: 38-161
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-20
Family PDZ domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020317
Domain Number - Region: 627-707
Classification Level Classification E-value
Superfamily Connexin43 0.0942
Family Connexin43 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020317   Gene: ENSNLEG00000016714   Transcript: ENSNLET00000021332
Sequence length 1958
Comment pep:novel supercontig:Nleu1.0:GL397323.1:7809939:7949039:-1 gene:ENSNLEG00000016714 transcript:ENSNLET00000021332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATRRTGLPEGDGDKLKACEVSKNKDGKEQSETVSLSEDETFSWPGPKTVTLKRTSQGF
GFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCT
GDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQD
AYLKGNEAYSGNARNIPEPPPICYPWLPSAPSAMAQPVEISPPDSSLSKQQTSTPVLTQP
GRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLSNRNNHTGPSHRTEE
VRYGVNEQTSLKTVSRTTSPPLSVPTTHLIHQPAGSRSLETSGILLKSGNYSGHSDGISS
SRSQAVEAPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQ
STTDYNQVIPNRTTLQGRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGA
LTSPSVSFSNHRTRSWDYIEGQDETLENVNSGTPIPDSNGEKKQTYKWSGFTEQDDRRGI
YERPRQQEIRKSFRGSNFTVAPSVVNSDNRRMSGRGVGSVSQFKKIPPDLKTLQSNRNFQ
TTCGMSLPRGISQDRSPLVKVRSNSLKAPSTHVTKPSFSQKSFVSIKDQRPVNHLHQNSL
LNQQTWVRTDSAPDQQVETGKSPSLSGASAKPGPQSSENAGTSDLELPVSQRNQDLSLQE
AEIEQSDTLDNKEAVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARRE
VHIKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIAT
VPPSLTTSAPLIRRQLSHDHESVGPPSLDAQPNSKTERSKSYDEGLDDYREDAKLSFKHV
SSLKGIKIPDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQ
MYVVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLF
QAEDRDDMLAWIKRIQESSNLNEEDTGVTNRDLISRRIKEYNNLMSKAEPLPKTPRQSLS
IRQTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPNLMRKTFEKKPT
ATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELN
KGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLK
RLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTH
MPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGVSPG
DVSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNV
FFKKENVEQCHNDTKEESKKESGTLGRKQKIITAKENSTRKDPSTTKDEKISLGKESMPS
EEPSPPHNSKHNKSPTLSCRFAILKESPRSLLAQKSSHLEETGSDSGTLLSTSSQASLAR
FSMKKSTSPETKHREFLANVSTITSDYSTTSSATYLTSLDSSRLSPEVQSVAESKGDEAD
DERSELISEGRPVETDSESEFPVFPTALTSERLFQGKLQEVTKSSRRNSEGSELSCTEGS
LTSSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDAKNEKEAPSLTKVFDVMKKG
KSTGSLLTPTRGESEKQEPTWKTKIADRLKLRPRAPADDMFGVGNHKVNAETAKRKSIRR
RHTLGGHRDATEISVLNFWKVHEQSGERESELSAVNRLKPKCSAQDLSISDWLARERLRT
STSDLSRGESGDPQTENPSTRGIAKTDTPLSLHCDTGSSSSTLASTNRPLLSIPPQSPDQ
INGESFQNVSKNASSATNAQPHKLSETPGNKAEFHPCL
Download sequence
Identical sequences A0A2I3GYE3
XP_003269414.1.23891 ENSNLEP00000020317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]