SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020677 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020677
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-22
Family Spermadhesin, CUB domain 0.0000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020677   Gene: ENSNLEG00000017024   Transcript: ENSNLET00000021710
Sequence length 114
Comment pep:novel supercontig:Nleu1.0:GL397265.1:56943407:56945710:1 gene:ENSNLEG00000017024 transcript:ENSNLET00000021710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLVAPSDCGGHYTDEYGRIFNYVGPKTECVWIIELNPGEIVTVAIPDLKPRGFTCGKEY
VEVLDGPPGSESLGRICKAFSTFYHSSSNIITIKYSREPSHPPTFFEIYYFVDA
Download sequence
Identical sequences ENSNLEP00000020677 ENSNLEP00000020677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]