SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020962 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020962
Domain Number 1 Region: 65-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000793
Family I set domains 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020962   Gene: ENSNLEG00000017257   Transcript: ENSNLET00000022015
Sequence length 194
Comment pep:novel supercontig:Nleu1.0:GL397264.1:18433963:18437658:-1 gene:ENSNLEG00000017257 transcript:ENSNLET00000022015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMRHNWTPDLSPLWVLLLCVHIDTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPA
AKQCPALEVTWPEVEVPLNGTLTLSCMACSRFPNFSILYWLGNGSFIEHLPGRLREGRTS
REHGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPGQVVQHHVVLAQLWAGLRTTLPPTQ
EALPSSHSSPQQQG
Download sequence
Identical sequences G1S624
ENSNLEP00000020962 ENSNLEP00000020962 XP_003254823.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]