SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021218 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021218
Domain Number 1 Region: 716-1071
Classification Level Classification E-value
Superfamily RNI-like 1.69e-86
Family 28-residue LRR 0.00000816
Further Details:      
 
Domain Number 2 Region: 8-97
Classification Level Classification E-value
Superfamily DEATH domain 4e-27
Family Pyrin domain, PYD 0.0085
Further Details:      
 
Domain Number 3 Region: 149-264,297-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000168
Family RecA protein-like (ATPase-domain) 0.089
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021218
Domain Number - Region: 661-709
Classification Level Classification E-value
Superfamily RNI-like 0.000785
Family 28-residue LRR 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021218   Gene: ENSNLEG00000017479   Transcript: ENSNLET00000022294
Sequence length 1092
Comment pep:novel supercontig:Nleu1.0:GL397264.1:21584092:21635512:1 gene:ENSNLEG00000017479 transcript:ENSNLET00000022294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSSSSFFPDFGLLLYLEELNKEELNTFKLFLKETMEPEHGLTPWTEVKKARREDLAN
LMKKYYPGEKAWSVSLKIFGKMNLKDLCERAKAEINWSAQSIGPDDAKAGETQEDQEAVV
GDGTEYRIRIKEKFCITWDKKSLAGKPEDFHHGIAENDRKLLEHLFDVDVKTGEQPQIVV
LQGAAGVGKTTLVRKAMLDWAEGNLYQQRFTYVFYLNGREINQLKERSFAQLISKDWPST
EGPIEEIISQPSSLLFIIDSFDELNFAFEEPEFALCEDWTQEHPVSFLMSSLLRKVLLPE
ASLLVTARLTASKRLKQLLKNHRYVELLGMSEDAREEYIYQFFEDKRWAMKVFSSLKSNE
MLFSMCQVPLVCWATCTCLKQQMEKGGDVTLTCQTTTALFTCYISSLFTPIDGRSPSLPN
QAQLRRLCQVAAKGIWTMTYVFYRENLRRLGLTKSDVSSFLDSNIIQKDAEYENCYVFTH
LHVQEFFAAMFYMLKGNWEAGNPSCQPFEDLKSLLQSTSYKDPQLTQMKCFLFGLLNEDR
VKQLERTFNCKMSLKVKSKLLQCMEVLGNSDYSPSQLGFLELFHYLYETQDKAFMSQAMR
YFPKVAINICEKIHLLVSSFCLKHCRCLRTIRLSVTVVFEKKIFKTSLPTNTWDGDRITH
CWQDLCSVLHTNEHLRELDLCHSNLDKSAMNILHHELRHPNCKLQKLLLKFITFPDGCQD
ISTSLIHNKNLMHLDLKGSDIGDNGVKSLCEALKHPECKLQTLRLESCNLTVFCCLNISN
ALIRSQSLIFLNLSTNNLLDDGVQLLCEALRHPKCYLERLSLESCGLTEAGCEDLSLALI
SNKRLTHLCLADNILGDGGVKLMSDALQHAQCTLKSLVLRRCHFTSLSSEYLSTSLLHNK
SLTHLDLGSNWLQDNGVKLLCDVFRHPSCNLQDLELMGCVLTNACCLDLASVILNNPNLR
SLDLGNNDLQDDGVKILCDALRYPNCNIQRLGLEYCGLTSLCCQDLSSALICNKRLIKMN
LTQNTLGYEGIVKLYKVLKSPKCKLQVLGLCKEAFDEEAQKLLEAVGVSNPHLIIKPDCN
YHNEDVSWWRCF
Download sequence
Identical sequences G1S6S9
ENSNLEP00000021218 ENSNLEP00000021218 XP_003254928.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]