SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021270 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021270
Domain Number 1 Region: 83-357
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.89e-80
Family Mitochondrial carrier 0.0000648
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily EF-hand 0.0000000213
Family Polcalcin 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021270   Gene: ENSNLEG00000017522   Transcript: ENSNLET00000022350
Sequence length 366
Comment pep:novel supercontig:Nleu1.0:GL397294.1:22218528:22229638:1 gene:ENSNLEG00000017522 transcript:ENSNLET00000022350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTI
FDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNN
MGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHER
LVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNM
LGIIPYAGIDLAVYETLKNAWLQRYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRT
RMQAQASIEGAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKIT
LGVQSR
Download sequence
Identical sequences XP_018889239.1.27298 XP_018889240.1.27298 ENSNLEP00000021270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]